Continuity
26.4/ 100
How much of the actual person could plausibly continue or be brought back.
Human Preservation Rating
MyHeritage
Legacy
30.2/ 100
How richly others can remember, reconstruct, or study the person later.
What this preserves
Family tree, genealogy record, and DNA-linked ancestry platform.
Public dimension scores
We show only high-confidence dimensions here. Lower-confidence machine calls stay internal until the evidence is good enough. That keeps hallucinations minimized.
8 dimensions withheld by the public confidence gate.
No high-confidence public dimension scores yet.
Facet coverage
Body
Not shownPhysical body or tissue substrate preservation.
Fidelity0.0 / 10
No evidence shows preservation of bodily tissue, cells, organs, or the physical body. The available material is about family trees, genealogy records, and DNA-linked ancestry data.
Brain / connectome
Not shownBrain structure, connectome, or neural substrate preservation.
Fidelity0.0 / 10
No evidence shows preservation of brain structure, neural tissue, or connectome-level data.
Genome
CoveredGenetic blueprint preservation.
Fidelity5.0 / 10
The evidence explicitly points to DNA-linked ancestry data and DNA trait outputs. That is partial genome-related preservation, but the record here does not show full genomic storage details or retention terms.
Memories
Not shownAutobiographical memories and life stories.
Fidelity0.0 / 10
No evidence shows storage of autobiographical memories, journals, life narratives, or personal recollections.
Personality
Not shownStable traits, conversational style, preferences, and temperament.
Fidelity0.0 / 10
No evidence shows preservation of conversational style, temperament, or stable personality profiles. DNA trait videos are mentioned, but that is not enough to claim personality preservation.
Social graph
Not shownRelationships, affiliations, and interaction history.
Fidelity0.0 / 10
The evidence mentions family tree relationships, but in an ancestry context rather than a preserved social graph of lived interactions, affiliations, or relationship history.
Likeness
CoveredFace, image, video, avatar, or visual representation.
Fidelity3.0 / 10
The evidence says DNA trait outputs are used to generate personalized videos. That supports some visual representation of a person, but the record is thin and does not show durable avatar or face-model preservation.
Voice
Not shownVoice recordings or voice model representation.
Fidelity0.0 / 10
No evidence shows storage of voice recordings or creation of voice models.
Values / beliefs
Not shownStated values, beliefs, commitments, and opinions.
Fidelity0.0 / 10
No evidence shows preservation of stated beliefs, commitments, opinions, or moral preferences.
Genealogy
CoveredLineage, ancestry, family records, and inherited identity.
Fidelity8.0 / 10
This is the clearest covered facet. The evidence directly describes MyHeritage as a family tree, genealogy record, and DNA-linked ancestry platform, with preserved family tree relationships and genealogy records.
Behavioral preferences
Not shownChoices, habits, tastes, and behavior patterns.
Fidelity0.0 / 10
No evidence shows preservation of habits, tastes, decisions, or behavior patterns.
Structured evidence
No structured public evidence has been extracted yet.
Evidence sources
- Wayback snapshot 20060104wayback snapshotwaybackweb.archive.orgJan 4, 2006
- Wayback snapshot 20050125wayback snapshotwaybackweb.archive.orgJan 25, 2005
- Wayback snapshot 20040206wayback snapshotwaybackweb.archive.orgFeb 6, 2004
- Wayback snapshot 20030923wayback snapshotwaybackweb.archive.orgSep 23, 2003
- Wayback snapshot 20020122wayback snapshotwaybackweb.archive.orgJan 22, 2002
- MyHeritage Founder and CEO Gilad Japhet at RootsTech 2020videospeeches youtubeyoutube.com
- YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- Gilad Japhet's Keynote Address [MyHeritage LIVE, November 2018]videospeeches youtubeyoutube.com
- YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- MyHeritage CEO Gilad Japhet Addresses RootsTech 2023 - YouTubevideospeeches youtubeyoutube.com
- YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- Trailer for BBC World News interview with MyHeritage CEO - YouTubevideospeeches youtubeyoutube.com
- YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- MyHeritage Founder & CEO Gilad Japhet's Session at RootsTech ...videospeeches youtubeyoutube.com
- YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- Interview with Gilad Japhet, MyHeritage Founder and CEO - YouTubevideospeeches youtubeyoutube.com
- YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- Fabulous Photo Discoveries™ At MyHeritagepodcastspeeches podcastseducation.myheritage.com
Request unsuccessful. Incapsula incident ID: 633000660028124932-82714069365756037
- Catch Up with MyHeritage's Daniel Horowitz: Episode 44podcastspeeches podcastsfamilytreemagazine.com
Catch Up with MyHeritage's Daniel Horowitz: Episode 44 - Family Tree Magazine --> Buy Digital Membership Subscribe to Print --> --> LOG IN SIGNUP / MENU MENU Get Started Explore by Topic Record Types Birth, Marriage, Death + Divorce Census Church Courthouse Immigration + Nat…
- Have you subscribed to the new MyHeritage podcast yet? Subscribe ...podcastspeeches podcastsfacebook.com
Have you subscribed to the new MyHeritage podcast yet? Subscribe and follow to Blast From My Past and you may win a MyHeritage Complete Plan! To enter, comment below that you’re following the podcast on one of our podcast streaming platforms. We’ll notify the winners on Sunday, M…
- MyHeritage - YouTubepodcastspeeches podcastsyoutube.com
MyHeritage - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- Blast From My Past: A New Podcast by MyHeritagepodcastspeeches podcastsblog.myheritage.com
Request unsuccessful. Incapsula incident ID: 633000660028124458-28227057686745216
- We just launched Traits Videos Here's an example from our team ...interviewinterviewinstagram.com
Instagram Instagram Log In Sign Up Close Never miss a post from myheritage_official Sign up for Instagram to stay in the loop. Sign up Log in myheritage_official Verified • Follow More options myheritage_official Verified 11w We just launched Traits Videos 🎬 Here’s an example fr…
- MyHeritage | DNAeXplained – Genetic Genealogyinterviewinterviewdna-explained.com
MyHeritage | DNAeXplained – Genetic Genealogy Skip to primary content Skip to secondary content DNAeXplained – Genetic Genealogy Discovering Your Ancestors – One Gene at a Time Search Main menu Home About Me About the Blog Acadians Help In Search of Unknown Fami…
- Gilad Japhet - Wikipediawikipediawikipediaen.wikipedia.org
Gilad Japhet - Wikipedia Jump to content Main menu Main menu move to sidebar hide Navigation Main page Contents Current events Random article About Wikipedia Contact us Contribute Help Learn to edit Community portal Recent changes Upload file Special pages Search Search Appearanc…
- Introducing the MyHeritage Wiki - YouTubewikipediawikipediayoutube.com
- YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC
- The MyHeritage Wiki: the ultimate family history resourcewikipediawikipediamyheritage.com
Request unsuccessful. Incapsula incident ID: 7233000660005031961-6654476773560454
- MyHeritage - Wikipediawikipediawikipediaen.wikipedia.org
MyHeritage - Wikipedia Jump to content Main menu Main menu move to sidebar hide Navigation Main page Contents Current events Random article About Wikipedia Contact us Contribute Help Learn to edit Community portal Recent changes Upload file Special pages Search Search Appearance…
- Synthetic Heritage: Online platforms, deceptive genealogy and the ...news articlepress generalcambridge.org
Synthetic Heritage: Online platforms, deceptive genealogy and the ethics of algorithmically generated memory | Memory, Mind & Media | Cambridge Core Skip to main content Accessibility help Login Alert Cancel Log in × × Discover Content Products and Services Register Log…
- 'Spooky' AI tool brings dead relatives' photos to lifenews articlepress generalnews.trust.org
MyHeritage AI tool brings dead relatives' photos to life × Our award-winning reporting has moved Context provides news and analysis on three of the world’s most critical issues: climate change, the impact of technology on society, and inclusive economies. BROWSE THE ARCHIVE VISIT…
- MyHeritage Acquires Promethease and SNPediatos privacytos privacyblog.myheritage.com
Request unsuccessful. Incapsula incident ID: 633000660028019065-82452849454813317
- LiveMemory™ Video Ownership, Responsibility and Your Privacytos privacytos privacymyheritage.com
Request unsuccessful. Incapsula incident ID: 7233000660005031961-10081512783417485
- LiveMemory™ Video Ownership, Responsibility and Your Privacy ...tos privacytos privacymyheritage.com
Request unsuccessful. Incapsula incident ID: 7233000660005031961-5128779835969675
- 4 Common Myths About DNA Testing - MyHeritage Knowledge Baseabout pageabout pageeducation.myheritage.com
Request unsuccessful. Incapsula incident ID: 633000660028019074-70105789141422212
- About MyHeritage | Company History and Cultureabout pageabout pagemyheritage.com
Request unsuccessful. Incapsula incident ID: 7233000660005031961-5106939927269515
- MyHeritagewebsitewebsitemyheritage.com
Request unsuccessful. Incapsula incident ID: 7233000660005031961-14310810029461646