Live·Open questions in longevity research
Human Preservation Rating

MyHeritage

GenealogyRated Jun 18, 2026Website ↗
Continuity
26.4/ 100

How much of the actual person could plausibly continue or be brought back.

Legacy
30.2/ 100

How richly others can remember, reconstruct, or study the person later.

What this preserves

Family tree, genealogy record, and DNA-linked ancestry platform.

Public dimension scores

We show only high-confidence dimensions here. Lower-confidence machine calls stay internal until the evidence is good enough. That keeps hallucinations minimized.

8 dimensions withheld by the public confidence gate.

No high-confidence public dimension scores yet.

Facet coverage

Body

Not shown

Physical body or tissue substrate preservation.

Fidelity0.0 / 10

No evidence shows preservation of bodily tissue, cells, organs, or the physical body. The available material is about family trees, genealogy records, and DNA-linked ancestry data.

Brain / connectome

Not shown

Brain structure, connectome, or neural substrate preservation.

Fidelity0.0 / 10

No evidence shows preservation of brain structure, neural tissue, or connectome-level data.

Genome

Covered

Genetic blueprint preservation.

Fidelity5.0 / 10

The evidence explicitly points to DNA-linked ancestry data and DNA trait outputs. That is partial genome-related preservation, but the record here does not show full genomic storage details or retention terms.

Memories

Not shown

Autobiographical memories and life stories.

Fidelity0.0 / 10

No evidence shows storage of autobiographical memories, journals, life narratives, or personal recollections.

Personality

Not shown

Stable traits, conversational style, preferences, and temperament.

Fidelity0.0 / 10

No evidence shows preservation of conversational style, temperament, or stable personality profiles. DNA trait videos are mentioned, but that is not enough to claim personality preservation.

Social graph

Not shown

Relationships, affiliations, and interaction history.

Fidelity0.0 / 10

The evidence mentions family tree relationships, but in an ancestry context rather than a preserved social graph of lived interactions, affiliations, or relationship history.

Likeness

Covered

Face, image, video, avatar, or visual representation.

Fidelity3.0 / 10

The evidence says DNA trait outputs are used to generate personalized videos. That supports some visual representation of a person, but the record is thin and does not show durable avatar or face-model preservation.

Voice

Not shown

Voice recordings or voice model representation.

Fidelity0.0 / 10

No evidence shows storage of voice recordings or creation of voice models.

Values / beliefs

Not shown

Stated values, beliefs, commitments, and opinions.

Fidelity0.0 / 10

No evidence shows preservation of stated beliefs, commitments, opinions, or moral preferences.

Genealogy

Covered

Lineage, ancestry, family records, and inherited identity.

Fidelity8.0 / 10

This is the clearest covered facet. The evidence directly describes MyHeritage as a family tree, genealogy record, and DNA-linked ancestry platform, with preserved family tree relationships and genealogy records.

Behavioral preferences

Not shown

Choices, habits, tastes, and behavior patterns.

Fidelity0.0 / 10

No evidence shows preservation of habits, tastes, decisions, or behavior patterns.

Structured evidence

No structured public evidence has been extracted yet.

Evidence sources

  1. Wayback snapshot 20060104
    wayback snapshotwaybackweb.archive.orgJan 4, 2006
  2. Wayback snapshot 20050125
    wayback snapshotwaybackweb.archive.orgJan 25, 2005
  3. Wayback snapshot 20040206
    wayback snapshotwaybackweb.archive.orgFeb 6, 2004
  4. Wayback snapshot 20030923
    wayback snapshotwaybackweb.archive.orgSep 23, 2003
  5. Wayback snapshot 20020122
    wayback snapshotwaybackweb.archive.orgJan 22, 2002
  6. MyHeritage Founder and CEO Gilad Japhet at RootsTech 2020
    videospeeches youtubeyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  7. Gilad Japhet's Keynote Address [MyHeritage LIVE, November 2018]
    videospeeches youtubeyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  8. MyHeritage CEO Gilad Japhet Addresses RootsTech 2023 - YouTube
    videospeeches youtubeyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  9. Trailer for BBC World News interview with MyHeritage CEO - YouTube
    videospeeches youtubeyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  10. MyHeritage Founder & CEO Gilad Japhet's Session at RootsTech ...
    videospeeches youtubeyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  11. Interview with Gilad Japhet, MyHeritage Founder and CEO - YouTube
    videospeeches youtubeyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  12. Fabulous Photo Discoveries™ At MyHeritage
    podcastspeeches podcastseducation.myheritage.com

    Request unsuccessful. Incapsula incident ID: 633000660028124932-82714069365756037

  13. Catch Up with MyHeritage's Daniel Horowitz: Episode 44
    podcastspeeches podcastsfamilytreemagazine.com

    Catch Up with MyHeritage's Daniel Horowitz: Episode 44 - Family Tree Magazine --> Buy Digital Membership Subscribe to Print --> --> LOG IN SIGNUP / MENU MENU Get Started Explore by Topic Record Types Birth, Marriage, Death + Divorce Census Church Courthouse Immigration + Nat…

  14. Have you subscribed to the new MyHeritage podcast yet? Subscribe ...
    podcastspeeches podcastsfacebook.com

    Have you subscribed to the new MyHeritage podcast yet? Subscribe and follow to Blast From My Past and you may win a MyHeritage Complete Plan! To enter, comment below that you’re following the podcast on one of our podcast streaming platforms. We’ll notify the winners on Sunday, M…

  15. MyHeritage - YouTube
    podcastspeeches podcastsyoutube.com

    MyHeritage - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  16. Blast From My Past: A New Podcast by MyHeritage
    podcastspeeches podcastsblog.myheritage.com

    Request unsuccessful. Incapsula incident ID: 633000660028124458-28227057686745216

  17. We just launched Traits Videos Here's an example from our team ...
    interviewinterviewinstagram.com

    Instagram Instagram Log In Sign Up Close Never miss a post from myheritage_official Sign up for Instagram to stay in the loop. Sign up Log in myheritage_official Verified • Follow More options myheritage_official Verified 11w We just launched Traits Videos 🎬 Here’s an example fr…

  18. MyHeritage | DNAeXplained – Genetic Genealogy
    interviewinterviewdna-explained.com

    MyHeritage | DNAeXplained – Genetic Genealogy Skip to primary content Skip to secondary content DNAeXplained – Genetic Genealogy Discovering Your Ancestors – One Gene at a Time Search Main menu Home About Me About the Blog Acadians Help In Search of Unknown Fami…

  19. Gilad Japhet - Wikipedia
    wikipediawikipediaen.wikipedia.org

    Gilad Japhet - Wikipedia Jump to content Main menu Main menu move to sidebar hide Navigation Main page Contents Current events Random article About Wikipedia Contact us Contribute Help Learn to edit Community portal Recent changes Upload file Special pages Search Search Appearanc…

  20. Introducing the MyHeritage Wiki - YouTube
    wikipediawikipediayoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  21. The MyHeritage Wiki: the ultimate family history resource
    wikipediawikipediamyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660005031961-6654476773560454

  22. MyHeritage - Wikipedia
    wikipediawikipediaen.wikipedia.org

    MyHeritage - Wikipedia Jump to content Main menu Main menu move to sidebar hide Navigation Main page Contents Current events Random article About Wikipedia Contact us Contribute Help Learn to edit Community portal Recent changes Upload file Special pages Search Search Appearance…

  23. Synthetic Heritage: Online platforms, deceptive genealogy and the ...
    news articlepress generalcambridge.org

    Synthetic Heritage: Online platforms, deceptive genealogy and the ethics of algorithmically generated memory | Memory, Mind & Media | Cambridge Core Skip to main content Accessibility help Login Alert Cancel Log in × × Discover Content Products and Services Register Log…

  24. 'Spooky' AI tool brings dead relatives' photos to life
    news articlepress generalnews.trust.org

    MyHeritage AI tool brings dead relatives' photos to life × Our award-winning reporting has moved Context provides news and analysis on three of the world’s most critical issues: climate change, the impact of technology on society, and inclusive economies. BROWSE THE ARCHIVE VISIT…

  25. MyHeritage Acquires Promethease and SNPedia
    tos privacytos privacyblog.myheritage.com

    Request unsuccessful. Incapsula incident ID: 633000660028019065-82452849454813317

  26. LiveMemory™ Video Ownership, Responsibility and Your Privacy
    tos privacytos privacymyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660005031961-10081512783417485

  27. LiveMemory™ Video Ownership, Responsibility and Your Privacy ...
    tos privacytos privacymyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660005031961-5128779835969675

  28. 4 Common Myths About DNA Testing - MyHeritage Knowledge Base
    about pageabout pageeducation.myheritage.com

    Request unsuccessful. Incapsula incident ID: 633000660028019074-70105789141422212

  29. About MyHeritage | Company History and Culture
    about pageabout pagemyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660005031961-5106939927269515

  30. MyHeritage
    websitewebsitemyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660005031961-14310810029461646

MyHeritage Human Preservation rating — Eternal Search